PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.12478s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 287aa    MW: 31405.6 Da    PI: 8.2651
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.12478s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.5e-3846105463
                zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                           +a++cprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+r+nk+sss
  Araha.12478s0001.1.p  46 EAQNCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSS 105
                           5789****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-234697IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3247102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.97548102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDPPQEISNE TLETILVSST KGNNNNNKKM EEEMKKKVSR GELGGEAQNC PRCESPNTKF  60
CYYNNYSLSQ PRYFCKSCRR YWTKGGTLRN VPVGGGCRRN KRSSSSAFSK NNNKSISFHN  120
DPLQNSLITG MPPSSYGYDS IDLNLAFATL QKHHSSSQAT TPSFGFGGDL SIYGNSANDV  180
GIFGGQNGNF NNSLCYGFMS GNGNNHQNEI KMASTLGMSL EGNERKQENV NNNNNSSENP  240
SKVLWGFPWQ MNGDSAGVVP EIDPGRESWN GMASSWNNGL LNTPLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0704210.0AY070421.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g28510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880989.10.0hypothetical protein ARALYDRAFT_481761
SwissprotQ8LE431e-172DOF21_ARATH; Dof zinc finger protein DOF2.1
TrEMBLD7LJK00.0D7LJK0_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.4__821__AT2G28510.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.11e-151Dof family protein